Iright
BRAND / VENDOR: Proteintech

Proteintech, 81728-1-RR, IBA1 Recombinant monoclonal antibody

CATALOG NUMBER: 81728-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The IBA1 (81728-1-RR) by Proteintech is a Recombinant antibody targeting IBA1 in WB, IHC, IHC-Autostainer, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 81728-1-RR targets IBA1 in WB, IHC, IHC-Autostainer, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: THP-1 cells, U-937 cells, HL-60 cells Positive IHC-Autostainer detected in: human tonsil tissue Positive IHC detected in: rat brain tissue, mouse brain tissue, human liver tissue, human tonsil tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Positive FC (Intra) detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC)-AUTOSTAINER: IHC-AUTOSTAINER : 1:50-1:500 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1363 Product name: Recombinant human IBA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC009474 Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP Predict reactive species Full Name: allograft inflammatory factor 1 Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC009474 Gene Symbol: IBA1 Gene ID (NCBI): 199 ENSEMBL Gene ID: ENSG00000204472 RRID: AB_2935574 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P55008 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924