Proteintech, 81754-1-RR, BCL6 Recombinant monoclonal antibody

Size: 20ul / 100ul The BCL6 (81754-1-RR) by Proteintech is a Recombinant antibody targeting BCL6 in WB, IHC, FC (Intra), IP, ELISA, ChIP-qPCR applications with reactivity to human, mouse samples 81754-1-RR targets BCL6 in WB, IHC, FC (Intra), IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Ramos cells, A20 cells, Daudi cells Positive IP detected in: Ramos cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: Ramos cells Positive ChIP-qPCR detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information BCL6, a zinc finger transcription factor, contains an N-terminal BTB/POZ domain and C-terminal zinc finger DNA-binding motifs and represses transcription of a wide range of target proteins and microRNAs. BCL6 protein has been reported as a master regulator of B lymphocyte development and growth, and altered BCL6 protein expression was implicated in pathogenesis of diverse human hematologic malignancies, especially in the diffuse large B cell lymphoma (DLBCL). BCL6 is required for the development of T follicular helper T cells (TFH), a helper T cell subset required for the formation of mature and productive GCs. BCL6 has also been shown to play important regulatory roles in macrophages. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15519 Product name: Recombinant human BCL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 183-532 aa of BC150184 Sequence: SLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEAS Predict reactive species Full Name: B-cell CLL/lymphoma 6 Calculated Molecular Weight: 706 aa, 79 kDa Observed Molecular Weight: 79-95 kDa GenBank Accession Number: BC150184 Gene Symbol: BCL6 Gene ID (NCBI): 604 RRID: AB_2935576 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41182 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.