Iright
BRAND / VENDOR: Proteintech

Proteintech, 82009-1-RR, Moesin Recombinant monoclonal antibody

CATALOG NUMBER: 82009-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Moesin (82009-1-RR) by Proteintech is a Recombinant antibody targeting Moesin in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 82009-1-RR targets Moesin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, SGC-7901 cells, NK-92 cells, Jurkat cells, C6 cells, RAW 264.7 cells Positive IHC detected in: mouse kidney tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information Moesin belongs to the ezrin-radixin-moesin (ERM) family of proteins which act as cross-linkers between membrane and actin cytoskeleton. ERM proteins provide structural links to strengthen the cell cortex and facilitate several key cellular processes, including membrane dynamics, substrate adhesion, cell survival, cell adhesion, and motility. The function of ERM proteins is highly reliant on phosphorylation induced conformational changes in response to growth factor, chemokine, and antigen stimulation. This antibody may cross-react with ezrin or radixin with molecular weights around 68-70 kDa. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9623 Product name: Recombinant human MSN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-294 aa of BC017293 Sequence: MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRR Predict reactive species Full Name: moesin Calculated Molecular Weight: 577 aa, 68 kDa Observed Molecular Weight: 68-70 kDa GenBank Accession Number: BC017293 Gene Symbol: Moesin Gene ID (NCBI): 4478 RRID: AB_2935596 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26038 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924