Proteintech, 82016-1-RR, STAT1 Recombinant monoclonal antibody

Size: 20ul / 100ul The STAT1 (82016-1-RR) by Proteintech is a Recombinant antibody targeting STAT1 in WB, IHC, IF/ICC, IP, ELISA, ChIP-qPCR applications with reactivity to human, mouse, rat samples 82016-1-RR targets STAT1 in WB, IHC, IF/ICC, IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, A549 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells Positive IP detected in: PC-3 cells Positive IHC detected in: human ovary tumor tissue, mouse spleen tissue, mouse colon tissue, rat colon tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: IFN alpha treated HeLa cells Positive ChIP-qPCR detected in: IFN-γ -HT-1080 (50 ng/ml, 30min) HT-1080 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information STAT1 (signal transducers and activators of transcription 1) is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. Various ligands, including interferons- and - , EGF, PDGF and IL-6, can activate STAT1. STAT1 protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0199 Product name: Recombinant human STAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-230 aa of BC002704 Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA Predict reactive species Full Name: signal transducer and activator of transcription 1, 91kDa Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 84 kDa GenBank Accession Number: BC002704 Gene Symbol: STAT1 Gene ID (NCBI): 6772 RRID: AB_2935597 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P42224 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.