Proteintech, 82441-1-RR, Cystatin C Recombinant monoclonal antibody

Size: 20ul / 100ul The Cystatin C (82441-1-RR) by Proteintech is a Recombinant antibody targeting Cystatin C in WB, IHC, ELISA applications with reactivity to Human samples 82441-1-RR targets Cystatin C in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HepG2 cells, human milk, human urine Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:15000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information Cystatin C is a 13-kDa inhibitor of cysteine proteinases which is secreted by all cell types and is completely cleared from the organism through glomerular filtration, shown to be an early and sensitive biomarker of renal dysfunction. It is also used as an emerging biomarker in cardiovascular disease. Cystatin C is involved in a variety of inflammatory reactions. The concentration of serum cystatin C has also been shown to be unaltered in certain inflammatory conditions or other disorders of metabolism. The plasma level of serum cystatin C can be expressed as its level of generation from cells and diet and its subsequent elimination through the gut, liver, and kidneys. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2890 Product name: Recombinant human Cystatin C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-146 aa of BC013083 Sequence: AGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Predict reactive species Full Name: cystatin C Calculated Molecular Weight: 146 aa, 16 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC013083 Gene Symbol: Cystatin C Gene ID (NCBI): 1471 RRID: AB_3086479 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01034 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.