Iright
BRAND / VENDOR: Proteintech

Proteintech, 82525-1-RR, WT1 Recombinant monoclonal antibody

CATALOG NUMBER: 82525-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The WT1 (82525-1-RR) by Proteintech is a Recombinant antibody targeting WT1 in WB, IP, ELISA applications with reactivity to human, mouse samples 82525-1-RR targets WT1 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells Positive IP detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The WT1 gene encodes a zinc finger DNA-binding protein that acts as a transcriptional activator or repressor depending on the cellular or chromosomal context, and it is required for the normal formation of the genitourinary system and mesothelial tissues. WT1 inhibits apoptosis through p53 and Bcl-2 and also inhibits the differentiation of leukemic cells. The function of WT1 may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has a lower affinity for DNA and can bind RNA. WT1 exists some isoforms with a range of molecular weight is 33-50 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19541 Product name: Recombinant human WT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-302 aa of BC032861 Sequence: MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRMHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL Predict reactive species Full Name: Wilms tumor 1 Calculated Molecular Weight: 449 aa, 49 kDa, 57 kDa Observed Molecular Weight: 52-55 kDa GenBank Accession Number: BC032861 Gene Symbol: WT1 Gene ID (NCBI): 7490 RRID: AB_3086487 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P19544 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924