Proteintech, 82678-2-RR, DNMT1 Recombinant monoclonal antibody

Size: 20ul / 100ul The DNMT1 (82678-2-RR) by Proteintech is a Recombinant antibody targeting DNMT1 in WB, FC (Intra), ELISA applications with reactivity to human, rat samples 82678-2-RR targets DNMT1 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293T cells, PC-12 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation, and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. (PMID: 10753866) Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29479 Product name: Recombinant human DNMT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 300-500 aa of BC126227 Sequence: KKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFA Predict reactive species Full Name: DNA (cytosine-5-)-methyltransferase 1 Calculated Molecular Weight: 1632 aa, 185 kDa Observed Molecular Weight: 200 kDa GenBank Accession Number: BC126227 Gene Symbol: DNMT1 Gene ID (NCBI): 1786 RRID: AB_3670526 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26358 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.