Proteintech, 82695-2-RR, MCL1 Recombinant monoclonal antibody

Size: 20ul / 100ul The MCL1 (82695-2-RR) by Proteintech is a Recombinant antibody targeting MCL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 82695-2-RR targets MCL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, MCF-7 cells, Jurkat cells, Raji cells, C2C12 cells, C6 cells Positive IHC detected in: human ovarian cancer, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MCL-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line. Similar to BCL2 and BCL2L1, MCL1 can interact with BAX and/or BAK1 to inhibit mitochondria-mediated apoptosis. Mcl-1 is critical for the proliferation and survival of myeloma cells in vitro, and overexpression of Mcl-1 protein in myeloma cells is associated with relapse and short event-free survival in multiple myeloma patients. Recent studies show that MCL-1 is upregulated in numerous haematological and solid tumour malignancies. Therefore, MCL-1 has been suggested as a potential new therapeutic target. MCL-1 can be alternatively spliced into a long form (MCL-1L, 40 kDa) or a short form (MCL-1S, 30 kDa). (PMID: 15467463, PMID: 15147382) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10397 Product name: Recombinant human MCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-327 aa of BC107735 Sequence: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG Predict reactive species Full Name: myeloid cell leukemia sequence 1 (BCL2-related) Calculated Molecular Weight: 350 aa, 37 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC107735 Gene Symbol: MCL1 Gene ID (NCBI): 4170 RRID: AB_3086508 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q07820 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.