Iright
BRAND / VENDOR: Proteintech

Proteintech, 82696-6-RR, IL-1 beta Recombinant monoclonal antibody

CATALOG NUMBER: 82696-6-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The IL-1 beta (82696-6-RR) by Proteintech is a Recombinant antibody targeting IL-1 beta in WB, IF/ICC, ELISA applications with reactivity to human samples 82696-6-RR targets IL-1 beta in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LPS and Protein transport inhibitor treated THP-1 cells Positive IF/ICC detected in: LPS treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0286 Product name: Recombinant Human IL-1 Beta protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species Full Name: interleukin 1, beta Calculated Molecular Weight: 269 aa, 31 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC008678 Gene Symbol: IL1B Gene ID (NCBI): 3553 ENSEMBL Gene ID: ENSG00000125538 RRID: AB_3086510 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924