Proteintech, 82701-3-RR, CPT1B Recombinant monoclonal antibody

Size: 20ul / 100ul The CPT1B (82701-3-RR) by Proteintech is a Recombinant antibody targeting CPT1B in WB, IHC, IF-P, ELISA applications with reactivity to mouse samples 82701-3-RR targets CPT1B in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17840 Product name: Recombinant human CPT1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-250 aa of BC131570 Sequence: FNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWF Predict reactive species Full Name: carnitine palmitoyltransferase 1B (muscle) Calculated Molecular Weight: 567 aa, 64 kDa Observed Molecular Weight: 70-85 kDa GenBank Accession Number: BC131570 Gene Symbol: CPT1B Gene ID (NCBI): 1375 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92523 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.