Proteintech, 82718-3-RR, ATG13 Recombinant monoclonal antibody

Size: 20ul / 100ul The ATG13 (82718-3-RR) by Proteintech is a Recombinant antibody targeting ATG13 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 82718-3-RR targets ATG13 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HEK- 293 cells, BGC-823 cells, SH-SY5Y cells, Jurkat cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ATG13 is one component protein of the ULK1 complex which is required for autophagosome formation and mitophagy. ATG13 has two nutrient regulatory phosphorylation sites and the phosphorylation status of ATG13 affect regulation of autophagy by modulating enzyme activity and cellular localization of ULK1. Besides, it has been reported the nonautophagic function of ATG13 on cardiac development for ATG13-deficient embryos show myocardial growth defects.(PMID:27387056, 26801615, 26644405) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13090 Product name: Recombinant human KIAA0652 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 131-481 aa of BC001331 Sequence: ITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ* Predict reactive species Full Name: KIAA0652 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC001331 Gene Symbol: ATG13 Gene ID (NCBI): 9776 RRID: AB_3086517 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75143 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.