Proteintech, 82739-1-RR, ZDHHC9 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZDHHC9 (82739-1-RR) by Proteintech is a Recombinant antibody targeting ZDHHC9 in WB, ELISA applications with reactivity to Human, mouse, rat samples 82739-1-RR targets ZDHHC9 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, SK-N-SH cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5400 Background Information ZDHHC9, also named as CXorf11, ZDHHC10, ZNF379 or ZNF380, is a 364 amino acid protein, which contains one DHHC-type zinc finger and belongs to the DHHC palmitoyltransferase activity. ZDHHC9 localizes in the endoplasmic reticulum membrane and is highly expressed in kidney, skeletal muscle, brain, lung and liver. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20881 Product name: Recombinant human ZDHHC9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 87-364 aa of BC006200 Sequence: SFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAAEAEK Predict reactive species Full Name: zinc finger, DHHC-type containing 9 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC006200 Gene Symbol: ZDHHC9 Gene ID (NCBI): 51114 RRID: AB_3086522 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y397 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.