Proteintech, 82741-2-RR, MRPS16 Recombinant monoclonal antibody

Size: 20ul / 100ul The MRPS16 (82741-2-RR) by Proteintech is a Recombinant antibody targeting MRPS16 in WB, IHC, ELISA applications with reactivity to human samples 82741-2-RR targets MRPS16 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, HT-1080 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9749 Product name: Recombinant human MRPS16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC021106 Sequence: MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET Predict reactive species Full Name: mitochondrial ribosomal protein S16 Calculated Molecular Weight: 137 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC021106 Gene Symbol: MRPS16 Gene ID (NCBI): 51021 RRID: AB_3086523 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y3D3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.