Proteintech, 82757-2-RR, IGF2BP2 Recombinant monoclonal antibody

Size: 20ul / 100ul The IGF2BP2 (82757-2-RR) by Proteintech is a Recombinant antibody targeting IGF2BP2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 82757-2-RR targets IGF2BP2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse kidney tissue, rat kidney tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: mouse kidney tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Insulin-like growth factor 2 mRNA-binding protein 2(IGF2BP2), ia a member of a family of mRNA binding protein, which can bind to several mammalian cells' mRNAs. Thus it may involve in the regulation of translation of mRNA. IGF2BP2's polymorphisms is risk factor for developing type 2 diabetes. This antibody raise against part of N-terminus of human IGF2BP2. IGF2BP2 has some isoforms with the MW of 54-66 kDa. Some literature has reported that multiple bands can be detected (PMID: 22427968, 36322753, 23069990). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2142 Product name: Recombinant human IGF2BP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-341 aa of BC021290 Sequence: MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIM Predict reactive species Full Name: insulin-like growth factor 2 mRNA binding protein 2 Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC021290 Gene Symbol: IGF2BP2 Gene ID (NCBI): 10644 RRID: AB_3086529 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y6M1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.