Iright
BRAND / VENDOR: Proteintech

Proteintech, 82787-2-RR, Cannabinoid receptor 1 Recombinant monoclonal antibody

CATALOG NUMBER: 82787-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Cannabinoid receptor 1 (82787-2-RR) by Proteintech is a Recombinant antibody targeting Cannabinoid receptor 1 in WB, ELISA applications with reactivity to human samples 82787-2-RR targets Cannabinoid receptor 1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12625 Product name: Recombinant human CNR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-121 aa of BC074812 Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV Predict reactive species Full Name: cannabinoid receptor 1 (brain) Calculated Molecular Weight: 472 aa, 53 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC074812 Gene Symbol: Cannabinoid receptor 1 Gene ID (NCBI): 1268 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21554 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924