Proteintech, 82792-2-RR, MUC2 Recombinant monoclonal antibody

Size: 20ul / 100ul The MUC2 (82792-2-RR) by Proteintech is a Recombinant antibody targeting MUC2 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 82792-2-RR targets MUC2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse colon tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse colon tissue, human colon tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25800 Product name: Recombinant human MUC2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 726-850 aa of M94132 Sequence: MYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWV Predict reactive species Full Name: mucin 2, oligomeric mucus/gel-forming Calculated Molecular Weight: 540 kDa GenBank Accession Number: M94132 Gene Symbol: MUC2 Gene ID (NCBI): 4583 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.