Iright
BRAND / VENDOR: Proteintech

Proteintech, 82794-7-RR, OX40L/TNFSF4 Recombinant monoclonal antibody

CATALOG NUMBER: 82794-7-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The OX40L/TNFSF4 (82794-7-RR) by Proteintech is a Recombinant antibody targeting OX40L/TNFSF4 in WB, IHC, IF/ICC, FC, ELISA applications with reactivity to human samples 82794-7-RR targets OX40L/TNFSF4 in WB, IHC, IF/ICC, FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MJ cells Positive FC detected in: MJ cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0582 Product name: Recombinant Human OX40L/TNFSF4 protein (His Tag) Source: mammalian cells -derived, pCDNA3.4-IGSF8(C6) Tag: N-6*His Domain: 51-183 aa of NM_003326.5 Sequence: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 4 Observed Molecular Weight: 30 kDa GenBank Accession Number: NM_003326.5 Gene Symbol: OX40L/TNFSF4 Gene ID (NCBI): 7292 RRID: AB_3670552 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P23510 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924