Iright
BRAND / VENDOR: Proteintech

Proteintech, 82798-3-RR, HNRNPC Recombinant monoclonal antibody

CATALOG NUMBER: 82798-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The HNRNPC (82798-3-RR) by Proteintech is a Recombinant antibody targeting HNRNPC in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 82798-3-RR targets HNRNPC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, K-562 cells, Jurkat cells, NIH/3T3 cells, HSC-T6 cells Positive IHC detected in: human stomach tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2356 Product name: Recombinant human HNRNPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC003394 Sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein C (C1/C2) Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC003394 Gene Symbol: HNRNPC Gene ID (NCBI): 3183 RRID: AB_3086542 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P07910 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924