Proteintech, 82822-2-RR, GPX4 (Human Specific) Recombinant monoclonal antibody

Size: 20ul / 100ul The GPX4 (Human Specific) (82822-2-RR) by Proteintech is a Recombinant antibody targeting GPX4 (Human Specific) in WB, ELISA applications with reactivity to human samples 82822-2-RR targets GPX4 (Human Specific) in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:15000 Background Information GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701).82822-2-RR is human specific. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species Full Name: glutathione peroxidase 4 (phospholipid hydroperoxidase) Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC021567 Gene Symbol: GPX4 Gene ID (NCBI): 2879 RRID: AB_3086547 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36969 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.