Product Description
Size: 20ul / 100ul
The Cytokeratin 14 (82824-1-RR) by Proteintech is a Recombinant antibody targeting Cytokeratin 14 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
82824-1-RR targets Cytokeratin 14 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse skin tissue, A431 cells, rat skin tissue
Positive IF/ICC detected in: A431 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:12000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
Cytokeratin 14, one of about 20 different cytokeratin isotypes of human cells, is the intermediate filament protein characteristic of epithelial cells. Cytokeratin 14 is expressed in the basal compartment of all stratified squamous epithelia. In various kinds of human tumors, the appearance and increasing expression of Cytokeratin 14 were strikingly associated with higher grade and stage of carcinoma, with varying degrees of unfavorable prognosis. In lung squamous cell carcinoma(LSCC), Cytokeratin 14 was expressed in the tumor cell nests showing stromal invasion with fibrosis and lymph node metastases, indicating that Cytokeratin 14 involved in proliferation and metastasis of LSCC. Cytokeratin 14 expression is sometimes used
in diagnosis of myoepithelioma1 and intraductal vs. invasive ductal carcinoma of the breast.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag17559 Product name: Recombinant human KRT14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 426-472 aa of BC002690 Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN Predict reactive species
Full Name: keratin 14
Calculated Molecular Weight: 472 aa, 52 kDa
Observed Molecular Weight: 52 kDa
GenBank Accession Number: BC002690
Gene Symbol: Cytokeratin 14
Gene ID (NCBI): 3861
RRID: AB_3086548
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P02533
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924