Iright
BRAND / VENDOR: Proteintech

Proteintech, 82873-2-RR, PIAS1 Recombinant monoclonal antibody

CATALOG NUMBER: 82873-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PIAS1 (82873-2-RR) by Proteintech is a Recombinant antibody targeting PIAS1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 82873-2-RR targets PIAS1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18132 Product name: Recombinant human PIAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 475-651 aa of BC121797 Sequence: PSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD Predict reactive species Full Name: protein inhibitor of activated STAT, 1 Calculated Molecular Weight: 651 aa, 72 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC121797 Gene Symbol: PIAS1 Gene ID (NCBI): 8554 RRID: AB_3670593 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75925 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924