Proteintech, 82879-1-RR, NOP58 Recombinant monoclonal antibody

Size: 20ul / 100ul The NOP58 (82879-1-RR) by Proteintech is a Recombinant antibody targeting NOP58 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 82879-1-RR targets NOP58 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, Jurkat cells, K-562 cells, HEK-293 cells Positive IP detected in: HeLa cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The box C/D snoRNPs are named for the short, conserved box C (UGAUGA) and box D (CUGA) sequences present in their RNA moiety. The box C/D sequences are also required for multiple aspects. of snoRNA biogenesis, including RNA stability, intronic processing, nucleolar targeting, nuclear retention, and 59 trimethylguanosine cap formation (PMID:9649444,8878486). Nop58 is a component common to the box C/D small nucleolar ribonucleoprotein (PMID:10606270). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5740 Product name: Recombinant human NOP58 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 279-529 aa of BC032592 Sequence: MMAIAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED Predict reactive species Full Name: NOP58 ribonucleoprotein homolog (yeast) Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC032592 Gene Symbol: NOP58 Gene ID (NCBI): 51602 RRID: AB_3670598 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y2X3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.