Proteintech, 82883-1-RR, OAS1 Recombinant monoclonal antibody

Size: 20ul / 100ul The OAS1 (82883-1-RR) by Proteintech is a Recombinant antibody targeting OAS1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 82883-1-RR targets OAS1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells Positive IHC detected in: mouse liver tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS1, are interferon-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). OAS1 (type I enzymes) has some isoforms with the MW of 40, 42, 44, 46, and 48 kDa (PMID:12590567, 19383565). OAS1 is a strong candidate for determining susceptibility or resistance to viral infections(PMID:15732009). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6793 Product name: Recombinant human OAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC000562 Sequence: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPA Predict reactive species Full Name: 2',5'-oligoadenylate synthetase 1, 40/46kDa Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC000562 Gene Symbol: OAS1 Gene ID (NCBI): 4938 RRID: AB_3670601 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P00973 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.