Iright
BRAND / VENDOR: Proteintech

Proteintech, 82910-2-RR, BAZ2A Recombinant monoclonal antibody

CATALOG NUMBER: 82910-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The BAZ2A (82910-2-RR) by Proteintech is a Recombinant antibody targeting BAZ2A in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 82910-2-RR targets BAZ2A in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, K-562 cells, MDA-MB-231 cells, PC-3 cells Positive IF/ICC detected in: U2OS cells, A549 cells Positive FC (Intra) detected in: U-2 OS Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information BAZ2A (bromodomain adjacent to zinc finger domain 2A), also known as TIP5. It is expected to be located in nucleus, and the protein is expressed at moderate levels in most tissues analyzed, including heart, brain, placenta, lung, skeletal muscle, kidney and pancreas. BAZ2A is an epigenetic regulator affecting transcription of ribosomal RNA, it is also a regulatory subunit of the ATP-dependent NoRC-1 and NoRC-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed:28801535). The calculated molecular weight of BAZ2A is 210 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33963 Product name: Recombinant human BAZ2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-295 aa of NM_013449.4 Sequence: QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILS Predict reactive species Full Name: bromodomain adjacent to zinc finger domain, 2A Calculated Molecular Weight: 211 kDa Observed Molecular Weight: 250-270 kDa GenBank Accession Number: NM_013449.4 Gene Symbol: BAZ2A Gene ID (NCBI): 11176 RRID: AB_3670641 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UIF9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924