Proteintech, 82945-1-RR, DGAT1 Recombinant monoclonal antibody

Size: 20ul / 100ul The DGAT1 (82945-1-RR) by Proteintech is a Recombinant antibody targeting DGAT1 in WB, ELISA applications with reactivity to Human, mouse, rat samples 82945-1-RR targets DGAT1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse liver tissue, HepG2 cells, PC-3 cells, THP-1 cells, Caco-2 cells, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32717 Product name: Recombinant human DGAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-300 aa of BC015762 Sequence: AHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM Predict reactive species Full Name: diacylglycerol O-acyltransferase homolog 1 (mouse) Calculated Molecular Weight: 488 aa, 55 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC015762 Gene Symbol: DGAT1 Gene ID (NCBI): 8694 RRID: AB_3391728 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75907 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.