Proteintech, 82950-1-RR, HEBP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The HEBP1 (82950-1-RR) by Proteintech is a Recombinant antibody targeting HEBP1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 82950-1-RR targets HEBP1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, L02 cells, HepG2 cells, rat liver tissue. mouse liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10538 Product name: Recombinant human HEBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC016277 Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT Predict reactive species Full Name: heme binding protein 1 Calculated Molecular Weight: 189 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC016277 Gene Symbol: HEBP1 Gene ID (NCBI): 50865 RRID: AB_3670693 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NRV9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.