Iright
BRAND / VENDOR: Proteintech

Proteintech, 82953-2-RR, uPAR/CD87 Recombinant monoclonal antibody

CATALOG NUMBER: 82953-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The uPAR/CD87 (82953-2-RR) by Proteintech is a Recombinant antibody targeting uPAR/CD87 in WB, IHC, ELISA applications with reactivity to human, mouse samples 82953-2-RR targets uPAR/CD87 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, U-251 cells, U-937 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human lung cancer tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information uPAR is a highly glycosylated, GPI-anchored membrane protein. In addition to the membrane-anchored form, uPAR is released from the plasma membrane by cleavage of the GPI anchor and can be found as a soluble form (suPAR). uPAR contains three homologous domains (D1-D3) of which the N-terminal one (D1) represents the uPA-binding domain. After binding to uPAR, uPA cleaves plasminogen, generating the active protease plasmin which is involved in a wide variety of physiologic and pathologic processes. In addition to regulating proteolysis, uPAR has important function in cell adhesion, migration and proliferation. Studies reveal that uPAR expression is elevated during inflammation and tissue remodeling and in many human cancers, in which it frequently indicates poor prognosis. (PMID 20027185; 12461559) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28056 Product name: Recombinant human uPAR, PLAUR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-305 aa of BC002788 Sequence: LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG Predict reactive species Full Name: PLAUR Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 35-50 kDa GenBank Accession Number: BC002788 Gene Symbol: uPAR Gene ID (NCBI): 5329 RRID: AB_3670697 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q03405 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924