Proteintech, 82965-1-RR, PGM5 Recombinant monoclonal antibody

Size: 20ul / 100ul The PGM5 (82965-1-RR) by Proteintech is a Recombinant antibody targeting PGM5 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples 82965-1-RR targets PGM5 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, PC-3 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Phosphoglucomutase-like protein 5 (also known as aciculin) is an enzyme encoded by the PGM5 gene. Gene functional studies show that PGM5 is similar to PGM1 but lacks enzymatic activity. PGM5 is tightly associated with the actin cytoskeleton and has primarily been investigated as an adhesion protein. It also functions as a cytoskeletal component of cell-matrix and cell-cell contacts in muscle and non-muscle cells. (PMID: 35819729) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34399 Product name: Recombinant human PGM5 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-80 aa of NM_021965 Sequence: MEGSPIPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGCTMVVGSDGRYFSRTAIEIVV Predict reactive species Full Name: phosphoglucomutase 5 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: NM_021965 Gene Symbol: PGM5 Gene ID (NCBI): 5239 RRID: AB_3670711 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15124 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.