Proteintech, 82967-1-RR, ACAP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ACAP1 (82967-1-RR) by Proteintech is a Recombinant antibody targeting ACAP1 in WB, IF/ICC, ELISA applications with reactivity to human samples 82967-1-RR targets ACAP1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ACAP1, also named as Centaurin-beta-1, is a 740 amino acid protein, which is expressed Highly in lung and spleen. ACAP1 as a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) is required for clathrin-dependent export of proteins from recycling endosomes to trans-Golgi network and cell surface and required for regulated export of ITGB1 from recycling endosomes to the cell surface and ITGB1-dependent cell migration. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34309 Product name: Recombinant human ACAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 163-270 aa of BC018543 Sequence: RAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEG Predict reactive species Full Name: ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 Calculated Molecular Weight: 740 aa, 82 kDa Observed Molecular Weight: 82-85 kDa GenBank Accession Number: BC018543 Gene Symbol: ACAP1 Gene ID (NCBI): 9744 RRID: AB_3670713 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15027 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.