Iright
BRAND / VENDOR: Proteintech

Proteintech, 82989-4-RR, Hif-1 alpha Recombinant monoclonal antibody

CATALOG NUMBER: 82989-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Hif-1 alpha (82989-4-RR) by Proteintech is a Recombinant antibody targeting Hif-1 alpha in WB, IHC, ELISA applications with reactivity to mouse samples 82989-4-RR targets Hif-1 alpha in WB, IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Cobalt Chloride treated NIH/3T3 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33620 Product name: Recombinant mouse Hif1a protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 530-825 aa of NM_001313919 Sequence: SEYCFDVDSDMVNVFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESNSPSPPSMSTVTGFQQTQLQKPTITATATTTATTDESKTETKDNKEDIKILIASPSSTQVPQETTTAKASAYSGTHSRTASPDRAGKRVIEQTDKAHPRSLNLSATLNQRNTVPEEELNPKTIASQNAQRKRKMEHDGSLFQAAGIGTLLQQPGDCAPTMSLSWKRVKGFISSEQNGTEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQG* Predict reactive species Full Name: hypoxia inducible factor 1, alpha subunit Calculated Molecular Weight: 93 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: NM_001313919 Gene Symbol: Hif1a Gene ID (NCBI): 15251 RRID: AB_3670737 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q61221 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924