Proteintech, 83010-1-RR, COL6A3 Recombinant monoclonal antibody

Size: 20ul / 100ul The COL6A3 (83010-1-RR) by Proteintech is a Recombinant antibody targeting COL6A3 in WB, ELISA applications with reactivity to human samples 83010-1-RR targets COL6A3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information COL6A3 belongs to the type VI collagen family. Collagen VI acts as a cell-binding protein. It is expected to be expressed in smooth muscle. And the calculated molecular weight of COL6A3 is 343 kDa. The protein has similar expression in obese and T2DM (2 patients, and it regulates the chemotaxis and inflammation of macrophages in adipose tissue. Its expression is also related to weight gain. The expression of this protein in adipocytes is related to insulin resistance, which is believed to depend on PPAR (peroxisome proliferator-activated receptor) α-mediated adipocyte development (PMID: 25337653). Defects in COL6A3 are a cause of Bethlem myopathy (BM). Defects in COL6A3 are a cause of Ullrich congenital muscular dystrophy (UCMD) which also known as Ullrich scleroatonic muscular dystrophy. This antibody is specific to COL6A3. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34752 Product name: Recombinant human COL6A3-Specific protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1630-1850 aa of NM_004369 Sequence: PSRPEKKKADIVFLLDGSINFRRDSFQEVLRFVSEIVDTVYEDGDSIQVGLVQYNSDPTDEFFLKDFSTKRQIIDAINKVVYKGGRHANTKVGLEHLRVNHFVPEAGSRLDQRVPQIAFVITGGKSVEDAQDVSLALTQRGVKVFAVGVRNIDSEEVGKIASNSATAFRVGNVQELSELSEQVLETLHDAMHETLCPGVTDAAKACNLDVILGFDGSRDQN Predict reactive species Full Name: collagen, type VI, alpha 3 Calculated Molecular Weight: 344 kDa Observed Molecular Weight: 300 kDa GenBank Accession Number: NM_004369 Gene Symbol: COL6A3 Gene ID (NCBI): 1293 RRID: AB_3670754 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P12111 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.