Proteintech, 83022-1-RR, TRPV2 Recombinant monoclonal antibody

Size: 20ul / 100ul The TRPV2 (83022-1-RR) by Proteintech is a Recombinant antibody targeting TRPV2 in WB, FC (Intra), ELISA applications with reactivity to human samples 83022-1-RR targets TRPV2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells Positive FC (Intra) detected in: K562, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information Transient receptor potential vanilloid 2 (TRPV2), also name as VRL-1, plays a critical role in neuronal development, cardiac function, immunity, and cancer (PMID: 31566564). It has been found to play an essential role in sustained intracellular Ca2+ concentration increase (PMID: 31857697). It's reported that TRPV2 is activated by high temperatures, with a threshold of around 52℃ (PMID: 10201375). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8864 Product name: Recombinant human TRPV2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC018926 Sequence: MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEE Predict reactive species Full Name: transient receptor potential cation channel, subfamily V, member 2 Calculated Molecular Weight: 764 aa, 86 kDa Observed Molecular Weight: ~80 kDa GenBank Accession Number: BC018926 Gene Symbol: TRPV2 Gene ID (NCBI): 51393 RRID: AB_3670763 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y5S1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.