Iright
BRAND / VENDOR: Proteintech

Proteintech, 83058-1-RR, Cytokeratin 13 Recombinant monoclonal antibody

CATALOG NUMBER: 83058-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Cytokeratin 13 (83058-1-RR) by Proteintech is a Recombinant antibody targeting Cytokeratin 13 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 83058-1-RR targets Cytokeratin 13 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HaCaT cells, A431 cells, mouse skin tissue, rat skin tissue, rat thymus tissue Positive IHC detected in: human urothelial carcinoma tissue, human cervical squamous cancer tissue, human oesophagus cancer tissue, mouse skin tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skin tissue Positive IF/ICC detected in: HaCaT cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Keratin 13 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in keratin 13 gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0217 Product name: Recombinant human KRT13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 183-458 aa of BC002661 Sequence: ARLAVDDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP Predict reactive species Full Name: keratin 13 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC002661 Gene Symbol: Cytokeratin 13 Gene ID (NCBI): 3860 RRID: AB_3670785 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P13646 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924