Proteintech, 83063-6-RR, MOG Recombinant monoclonal antibody

Size: 20ul / 100ul The MOG (83063-6-RR) by Proteintech is a Recombinant antibody targeting MOG in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 83063-6-RR targets MOG in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, pig brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Myelin/oligodendrocyte glycoprotein (MOG), a 23~28 kDa glycoprotein, a myelin antigen at the outer surface of the central nervous system (CNS) myelin sheath, which may trigger T-cell as well as B-cell responses. It therefore constitutes a pivotal target for autoimmune responses, which result in inflammation and also demyelination in the CNS. Its presence on the outer- most lamellae of mature CNS myelin and its late appearance during myelinogenesis suggest that it contributes to myelin maturation or maintenance. 10 isoforms of MOG produced by alternative splicing have been described, and heterodimers may be formed between the different isoforms. Defects in MOG are the cause of narcolepsy type 7 (NRCLP7), a neurological disabling sleep disorder characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Role of MOG in the pathogenesis of multiple sclerosis (MS) has been reported but remains to be clarified. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2878 Product name: Recombinant Human MOG protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 30-154 aa of N/A Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG Predict reactive species Full Name: myelin oligodendrocyte glycoprotein Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: N/A Gene Symbol: MOG Gene ID (NCBI): 4340 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16653-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.