Proteintech, 83082-4-RR, CA11 Recombinant monoclonal antibody

Size: 20ul / 100ul The CA11 (83082-4-RR) by Proteintech is a Recombinant antibody targeting CA11 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83082-4-RR targets CA11 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: A431 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CA11(Carbonic anhydrase-related protein 11) is also named CARP2, and CARP XI and belongs to the alpha-carbonic anhydrase family. CARP XI is observed in the cerebellum, cerebrum, liver, stomach, small intestine, colon, kidney, and testis by immunohistochemical, and in the cerebellum, the most prominent signal is located in the Purkinje cells(PMID:20356370). CARP XI contains a hydrophobic N-terminal region for a possible signal sequence and asparagine glycosylation site and it plays a general role in the human central nervous system(PMID: 10350627). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33373 Product name: Recombinant human CA11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 215-328 aa of BC002662 Sequence: DAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR Predict reactive species Full Name: carbonic anhydrase XI Calculated Molecular Weight: 36 kDa GenBank Accession Number: BC002662 Gene Symbol: CA11 Gene ID (NCBI): 770 RRID: AB_3670799 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O75493 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.