Proteintech, 83083-5-RR, DDX39A Recombinant monoclonal antibody

Size: 20ul / 100ul The DDX39A (83083-5-RR) by Proteintech is a Recombinant antibody targeting DDX39A in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83083-5-RR targets DDX39A in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, mouse kidney tissue, HeLa cells, HepG2 cells, Raji cells, A431 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information DDX39A, also named the BAT1 protein, contains the nine conserved motifs that characterize the DEAD-box family of RNA-binding proteins. The family includes proteins found in all eukaryotic cell types, with considerable divergence in the sequences lying between the conserved motifs. Some of the motifs were known before the definition of the family and are responsible for binding to mRNA or ATP, or possess ATPase activity. Phylogenetic analyses have grouped BAT1 with the defining member of the DEAD-box family, eIF-4. This is a translation initiation factor required for the dissociation of stem/loop structures in mRNA at the ribosomes. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2311 Product name: Recombinant human DDX39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-322 aa of BC032128 Sequence: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQPVTLSAVQGFPAADPGGHQSVWPGDGHRASQHRL Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 Calculated Molecular Weight: 427 aa, 49 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC032128 Gene Symbol: DDX39 Gene ID (NCBI): 10212 RRID: AB_3670800 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00148 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.