Iright
BRAND / VENDOR: Proteintech

Proteintech, 83085-3-RR, SLC35F4 Recombinant monoclonal antibody

CATALOG NUMBER: 83085-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The SLC35F4 (83085-3-RR) by Proteintech is a Recombinant antibody targeting SLC35F4 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83085-3-RR targets SLC35F4 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34518 Product name: Recombinant human SLC35F4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 471-521 aa of NM_001206920 Sequence: MLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA Predict reactive species Full Name: solute carrier family 35, member F4 Calculated Molecular Weight: 521 aa, 58 kDa GenBank Accession Number: NM_001206920 Gene Symbol: SLC35F4 Gene ID (NCBI): 341880 RRID: AB_3670801 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A4IF30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924