Iright
BRAND / VENDOR: Proteintech

Proteintech, 83087-2-RR, GDNF Recombinant monoclonal antibody

CATALOG NUMBER: 83087-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The GDNF (83087-2-RR) by Proteintech is a Recombinant antibody targeting GDNF in WB, ELISA applications with reactivity to human, mouse samples 83087-2-RR targets GDNF in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Glial-derived neurotrophic factor (GDNF) is a member of the transforming growth factor (TGF)-α family and exhibits potent neuroprotective activity. GDNF is a potent promoter of neuronal survival in the CNS and peripheral nervous system (PNS). It has a relatively high speciicity for dopaminergic neurons and thus become an efective treatment for Parkinson's diseases (PD), with clinical trials currently in progress. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24068 Product name: Recombinant human GDNF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-211 aa of BC069369 Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI Predict reactive species Full Name: glial cell derived neurotrophic factor Calculated Molecular Weight: 211 aa, 24 kDa Observed Molecular Weight: 24-30 kDa GenBank Accession Number: BC069369 Gene Symbol: GDNF Gene ID (NCBI): 2668 RRID: AB_3670803 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P39905 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924