Proteintech, 83142-4-RR, PPFIA3 Recombinant monoclonal antibody

Size: 20ul / 100ul The PPFIA3 (83142-4-RR) by Proteintech is a Recombinant antibody targeting PPFIA3 in WB, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 83142-4-RR targets PPFIA3 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HEK-293 cells, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive FC (Intra) detected in: U-251 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PPFIA3, also named as KIAA0654, belongs to the liprin family and Liprin-alpha subfamily. PPFIA3 may regulate the disassembly of focal adhesions. It may localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates. PPFIA3 exhibites more than 5 fold accumulations in the monoribosome fraction. PPFIA3 is decreased at the protein level by the miR-99 family but not in the luciferase reporter with the 3'UTR of PPFIA3. (PMID:21212412) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1971 Product name: Recombinant human PPFIA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-277 aa of BC021255 Sequence: APASSRTSTGNVWMTHEEMESLTATTKPILAYGDMNHEWVGNDWLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYDRKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDLRGVTPDSAEMLPPNFRSAAAGALGSPGLPLRKLQPEGQTSGSSRADGVSVRTYSC Predict reactive species Full Name: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3 Calculated Molecular Weight: 1194 aa, 133 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC021255 Gene Symbol: PPFIA3 Gene ID (NCBI): 8541 RRID: AB_3670843 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75145 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.