Proteintech, 83160-4-RR, IFI35 Recombinant monoclonal antibody

Size: 20ul / 100ul The IFI35 (83160-4-RR) by Proteintech is a Recombinant antibody targeting IFI35 in WB, IHC, ELISA applications with reactivity to human samples 83160-4-RR targets IFI35 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, MCF-7 cells, HepG2 cells, SW480 cells, Jurkat cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information IFI35 (interferon induced protein 35), also known as IFP35. It is expected to be located in cytoplasm, nucleus and extracellular space. The protein is expressed in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. Involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of signal transduction. And the calculated molecular weight of IFI35 is 31 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34653 Product name: Recombinant human IFI35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-203 aa of BC001356 Sequence: RKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVP Predict reactive species Full Name: interferon-induced protein 35 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: BC001356 Gene Symbol: IFI35 Gene ID (NCBI): 3430 RRID: AB_3670854 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P80217 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.