Proteintech, 83172-2-RR, USP8 Recombinant monoclonal antibody

Size: 20ul / 100ul The USP8 (83172-2-RR) by Proteintech is a Recombinant antibody targeting USP8 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83172-2-RR targets USP8 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, K-562 cells, A549 cells, HepG2 cells, HEK-293 cells, HeLa cells, MCF-7 cells Positive IF/ICC detected in: U2OS cells, HeLa cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information USP8 is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo sorting and membrane trafficking at the early endosome stage. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27143 Product name: Recombinant human USP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-253 aa of BC110590 Sequence: SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV Predict reactive species Full Name: ubiquitin specific peptidase 8 Calculated Molecular Weight: 1118 aa, 128 kDa Observed Molecular Weight: 128 kDa GenBank Accession Number: BC110590 Gene Symbol: USP8 Gene ID (NCBI): 9101 RRID: AB_3670867 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P40818 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.