Proteintech, 83175-2-RR, TRIM54 Recombinant monoclonal antibody

Size: 20ul / 100ul The TRIM54 (83175-2-RR) by Proteintech is a Recombinant antibody targeting TRIM54 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83175-2-RR targets TRIM54 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human heart tissue, mouse heart tissue Positive IF/ICC detected in: C2C12 cells, HepG2 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:14000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TRIM54 (Tripartite motif-containing protein 54) is also names as MURF, MURF3, RNF30. The expression of TRIM54 is required for skeletal myoblast differentiation and myotube fusion. It is expressed in heart and skeletal muscle specifically (PMID:11243782). It has two isoforms with the molecular weight of 40KDa and 45KDa. It can be dimerizated and hetero-dimerizated to form homooligomer and heterooligomer (PMID:15967462). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15229 Product name: Recombinant human TRIM54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-358 aa of BC141807 Sequence: IAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP Predict reactive species Full Name: tripartite motif-containing 54 Calculated Molecular Weight: 358 aa, 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC141807 Gene Symbol: TRIM54 Gene ID (NCBI): 57159 RRID: AB_3670869 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BYV2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.