Proteintech, 83206-1-RR, GRAF Recombinant monoclonal antibody

Size: 20ul / 100ul The GRAF (83206-1-RR) by Proteintech is a Recombinant antibody targeting GRAF in WB, ELISA applications with reactivity to human samples 83206-1-RR targets GRAF in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, A549 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information GTPase Regulator Associated with Focal Adhesion Kinase (GRAF), also known as Rho GTPase activating protein 26 (ARHGAP26) , is a GTPase-activating protein and inhibits the activity of Rho GTPases by promoting the hydrolytic ability of Rho GTPases. GRAF enhances the hydrolysis of GTPases and converts GTPases from an active form to an inactive form, thereby inhibiting signaling transduction. Deletion and mutation of ARHGAP26 can lead to promyelocytic leukemia, suggesting tumor suppressive activity of ARHGAP26. ARHGAP26 was downregulated in glioblastoma and associated with cell proliferation and migration (PMID: 10908648, PMID: 17611651, PMID: 31004081). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12008 Product name: Recombinant human ARHGAP26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 403-759 aa of BC068555 Sequence: RGINEQGLYRIVGVNSRVQKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL Predict reactive species Full Name: Rho GTPase activating protein 26 Calculated Molecular Weight: 759 aa, 86 kDa Observed Molecular Weight: 92-100 kDa GenBank Accession Number: BC068555 Gene Symbol: ARHGAP26 Gene ID (NCBI): 23092 RRID: AB_3670894 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UNA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.