Proteintech, 83213-10-RR, B7-2/CD86 Recombinant monoclonal antibody

Size: 20ul / 100ul The B7-2/CD86 (83213-10-RR) by Proteintech is a Recombinant antibody targeting B7-2/CD86 in WB, ELISA applications with reactivity to mouse samples 83213-10-RR targets B7-2/CD86 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: DC2.4 cells, mouse spleen tissue, Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0802 Product name: Recombinant Mouse CD86 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-245 aa of NM_019388 Sequence: VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKE Predict reactive species Full Name: CD86 antigen Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_019388 Gene Symbol: Cd86 Gene ID (NCBI): 12524 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P42082-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.