Iright
BRAND / VENDOR: Proteintech

Proteintech, 83214-5-RR, PDGF-BB Recombinant monoclonal antibody

CATALOG NUMBER: 83214-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PDGF-BB (83214-5-RR) by Proteintech is a Recombinant antibody targeting PDGF-BB in WB, ELISA applications with reactivity to human, mouse, rat samples 83214-5-RR targets PDGF-BB in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, A549 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Platelet-derived growth factor (PDGF) belongs to the family of growth factors consisting of four secreted extracellular ligands including PDGF-A, -B, -C and -D. These isoforms, PDGF-AA, PDGF-AB, PDGF-BB, PDGF-CC and PDGF-DD, act via two receptor tyrosine kinases, PDGF receptors alpha and beta. PDGF isoforms stimulate growth, survival and motility of mesenchymal cells and certain other cell type. They have important functions during embryonal development and in the control of tissue homeostasis in the adult. PDGF-BB is one of the most recently studied isoforms and it plays an important role in skeletal development. PDGF-BB stimulates cell-mediated collagen gel contraction. PDGF-BB modulates endothelial proliferation and angiogenesis in vitro via PDGF beta-receptors. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25986 Product name: Recombinant human PDGFB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC029822 Sequence: MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIA Predict reactive species Full Name: platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) Calculated Molecular Weight: 241 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC029822 Gene Symbol: PDGFB Gene ID (NCBI): 5155 RRID: AB_3670899 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P01127-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924