Proteintech, 83239-5-RR, SLC16A11 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC16A11 (83239-5-RR) by Proteintech is a Recombinant antibody targeting SLC16A11 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 83239-5-RR targets SLC16A11 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, mouse brain tissue, mouse stomach tissue Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24920 Product name: Recombinant human SLC16A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 397-471 aa of BC093860 Sequence: FLRDETGDFTASFLLSGSLILSGSFIYIGLPRALPSCGPASPPATPPPETGELLPAPQAVLLSPGGPGSTLDTTC Predict reactive species Full Name: solute carrier family 16, member 11 (monocarboxylic acid transporter 11) Calculated Molecular Weight: 471 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC093860 Gene Symbol: SLC16A11 Gene ID (NCBI): 162515 RRID: AB_3670915 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8NCK7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.