Iright
BRAND / VENDOR: Proteintech

Proteintech, 83240-5-RR, USP30 Recombinant monoclonal antibody

CATALOG NUMBER: 83240-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The USP30 (83240-5-RR) by Proteintech is a Recombinant antibody targeting USP30 in WB, FC (Intra), ELISA applications with reactivity to human samples 83240-5-RR targets USP30 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, A549 cells, HEK-293 cells, SH-SY5Y cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information USP30, a mitochondrion-localized deubiquitylase, regulates mitophagy. Mitochondrial damage stimulates parkin to assemble Lys 6, Lys 11 and Lys 63 chains on mitochondria, and that USP30 is a ubiquitin-specific deubiquitylase with a strong preference for cleaving Lys 6- and Lys 11-linked multimers. USP30 can be ubiquitinated by parkin (PARK2) at Lys-235 and Lys-289. USP30 inhibition is potentially beneficial for treating Parkinson disease by promoting mitochondrial clearance and quality control. USP30 was detected 67 kDa by ubiquitination (PMID: 34704599). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7620 Product name: Recombinant human USP30 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 159-508 aa of BC004868 Sequence: VITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE Predict reactive species Full Name: ubiquitin specific peptidase 30 Calculated Molecular Weight: 58.5 kDa Observed Molecular Weight: 59-67 kDa GenBank Accession Number: BC004868 Gene Symbol: USP30 Gene ID (NCBI): 84749 RRID: AB_3670916 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q70CQ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924