Proteintech, 83245-1-RR, Cxcl15 Recombinant monoclonal antibody

Size: 20ul / 100ul The Cxcl15 (83245-1-RR) by Proteintech is a Recombinant antibody targeting Cxcl15 in WB, ELISA applications with reactivity to mouse samples 83245-1-RR targets Cxcl15 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Cxcl15, also known as lungkine or WECHE, is a small cytokine belonging to the CXC chemokine family that has been described in the mouse. High levels of Cxcl15 mRNA were specifically detected in the lung and at lower levels in fetal lung tissue by Northern blot and in situ hybridization, suggesting a potential role for this chemokine during lung development. Moreover, the Cxcl15 protein is secreted into the airway spaces and induces the in vitro and in vivo migration of neutrophils, suggesting that it is involved in lung-specific neutrophil trafficking. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33964 Product name: Recombinant mouse Cxcl15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-127 aa of BC061138 Sequence: QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA Predict reactive species Full Name: chemokine (C-X-C motif) ligand 15 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC061138 Gene Symbol: Cxcl15 Gene ID (NCBI): 20309 RRID: AB_3670920 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9WVL7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.