Iright
BRAND / VENDOR: Proteintech

Proteintech, 83263-4-RR, GNA12 Recombinant monoclonal antibody

CATALOG NUMBER: 83263-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The GNA12 (83263-4-RR) by Proteintech is a Recombinant antibody targeting GNA12 in WB, ELISA applications with reactivity to human, mouse, rat samples 83263-4-RR targets GNA12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, HepG2 cells, HeLa cells, mouse pancreas tissue, rat pancreas tissue, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:14000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35068 Product name: Recombinant human GNA12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-172 aa of BC087537 Sequence: DKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSE Predict reactive species Full Name: guanine nucleotide binding protein (G protein) alpha 12 Observed Molecular Weight: 41 kDa GenBank Accession Number: BC087537 Gene Symbol: GNA12 Gene ID (NCBI): 2768 RRID: AB_3670934 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q03113 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924