Proteintech, 83264-5-RR, EFHD2 Recombinant monoclonal antibody

Size: 20ul / 100ul The EFHD2 (83264-5-RR) by Proteintech is a Recombinant antibody targeting EFHD2 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83264-5-RR targets EFHD2 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuH-7 cells, NCI-H1299 cells, A549 cells Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information EFHD2 also named Swiprosin-1, is a Ca2+ binding actin protein. The expression of EFHD2 is upregulated during the activation of immune cells, epithelial and endothelial cells. The expression of EFHD2 is regulated by diverse signaling pathways that are contingent upon the specific type of cells. EFHD2 consists of 240 amino-acids. Based on the composition, the predicted molecular weight was reported to be 27 KDa while the apparent molecular weight was 33 KDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35084 Product name: Recombinant human EFHD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-80 aa of BC023611 Sequence: ATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVF Predict reactive species Full Name: EF-hand domain family, member D2 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC023611 Gene Symbol: EFHD2 Gene ID (NCBI): 79180 RRID: AB_3670935 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96C19 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.